FOXO4

$267.00

Strength: 10 mg
CAS: 2460055-10-9
Chemical Formula: C₂₂₈H₃₈₈N₈₆O₆₄
Purity: 99.59%
Molecular weight: 5358.05 g/mol
Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Synonyms: FOXO4-DRI
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
COA Purity

FDA Disclaimer: The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease. All products are for laboratory developmental research USE ONLY. Products are not for human consumption.